Rpsa Rabbit Polyclonal Antibody TA335055 from OriGene Technologies | Biocompare.com

Supplier Images

Rpsa Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Rpsa Rabbit Polyclonal Antibody

OriGene Technologies' Rpsa Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Rpsa Rabbit Polyclonal Antibody was generated using Rpsa as the antigen and it reacts with Mouse.

Description

Rabbit Polyclonal Anti-Rpsa Antibody

Product Specs
ItemRpsa Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA335055
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetRpsa
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Rpsa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKL
NCBI Full Gene Nameribosomal protein SA
NCBI Gene AliasesLamr, Lamrl1, Lamr1, La, 67kDa, L, 67lr, MLR, P40-, P40-8, AL022858, P40-3, P40
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!